<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1943 1943-30602 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F I13V, Q18H, K20I, E35D, M36I, N37D, L63P, A71I, T74S, T91S  
>1943-30602| codons 4-99
TLWQRPFVTVKIGGHLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYDQIP
IEICGHKIIGSVLVGPTPVNVIGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KN K103N   K43E, V60I, V118I, Q174N, G196E, T200I, R211K  
>1943-30602| codons 38-247
CTELEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKNNPDIVIYQYMDDLYVGSDLEIEQHRIKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006