<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1984 1984-30602 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A L24I, L33F L10I, I13V, I62V, L63P, I64L, A71V, I72V, T74E, V77I, I93L  
>1984-30602| codons 4-99
TLWQRPIVTVKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKLIVGIGGFSKVRQYDQVP
LEICGHKVVGEVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N Y181C   T39TA, K43E, E44D, V118I, K122P, D177E, V179I, E203EK, H208Y, R211K, D218E, L228H, V245E  
>1984-30602| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIICQYMDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTP
ENKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006