<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1940 1940-30521 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70G, L74V, M184V   Y181C, G190A   K49R, S68G, S105T, D123E, I135T, V245Q V111VIM
>1940-30521| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKNGTGWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKTVTVLDMGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L33F, T74P L10I, V11L, I13V, R41K, K55KR, D60E, L63P, A71V, V77VI, I93L  
>1940-30521| codons 4-99
TLWQRPILTVKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKLIGGIGGFVRVRQYEQIP
IEICGHKVIGPVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006