<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1237 1237-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F, K43T, F53L, T74P L10IV, I13V, K14R, E21EQ, K55R, D60E, I62V, L63P, A71V, V77I  
>1237-30519| codons 4-99
TLWQRPVVTVRIGGQLKQALLDTGADDTVFEEMNLPGRWTPKIIGGVGGLVRVRQYEQVP
IEICGHKVIGPVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, T69TADN, L210LW T215TCS     K43KN, V118I, K122E, I135M, R172RK, Q174QK, G196GE, T200TA, R211RT, V245VE  
>1237-30519| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKKNPDIVIYQYMDDLYVGSDLEIEQHRAKIEELRQHLWTWGFSTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006