<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1941 1941-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54V, V82A, L90M K43T L10I, G16E, K20R, E35D, M36I, N37E, P39PS, I62V, L63H, A71I, V77I, I85V, I93L  
>1941-30519| codons 4-99
TLWQRPIVTIKIEGQLREALLDTGADDTVLEDIELSGRWTPKMIVGVGGFVKVRQYDQVH
IEICGHKIIGTVLIGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M T215I, K219E L100I, K103N   T69N, S162N, I178L, V179I, G196E, Q207N, R211K, L228H K122K*
>1941-30519| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLD*DFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQNSMTKILEPFRKQNPDLIIYQYMDDLYVGSDLEIEQHRTKIEELRNHLLKWGFITP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006