<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1240 1240-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82F, L90M L33F, Q58E L10I, K20R, E34EA, E35D, M36I, N37D, D60E, Q61D, L63P, C67E, A71V, I85IV, I93L  
>1240-30519| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFADIDLPGRWKPKLIGGIGGFLKVREYEDIP
IEIEGHKVIGTVLVGPTPFNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N   T39E, E44D, V118I, K122KE, I135IT, Q174QR, D177E, I178ILM, T200A, E203D, Q207K, R211D, E224ED  
>1240-30519| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEMVIYQYVDDLYVGSDLEIGQHRAKIDELRKHLWDWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006