<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1798 1798-30611 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V L33F, F53FL, G73S L10V, I13V, K55KN, D60DE, L63P, V77I, Q92K  
>1798-30611| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIVGGIGGLMNVRQYEQIP
IEICGHKAISTVLIGPTPVNVIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F V75L, K219Q L100I, K103N V108VI L109LM, D123E, S162Y, Q174H, D177E, I202V, Q207D, R211K, V241I  
>1798-30611| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKILDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTIMDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKHNPEIVIYQYMDDLYVGSDLEIGQHRTKVEELRDHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTIQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006