<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
143P12 143P12W104 U.S. 1993 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 16
2 DDI 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R       S68G, T69I, R83K, Q207E, R211K, L228K  
>143P12W104| codons 26-242
LTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDGIKWRKLVDFRELNKKTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEEL
REHLLKWGFTTPDKKHQKEPPFKWMGYELHPDKWTVQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, N37X, L63P, I93L  
>143P12W104| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMXLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Winters, MA Human immunodeficiency virus type 1 reverse transcriptase genotype and drug susceptibility changes in infected individuals receiving dideoxyinosine monotherapy for 1 to 2 years. AAC, 1997
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005