<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1226 1226-30620 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, Y181C   K43N, E79ED, K122E, Q174E, Q207E, R211K, L228LR  
>1226-30620| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRDLNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKENPDIVICQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, P39Q, R57K, Q61E, L63P, I64L, A71V, V77I, I93L  
>1226-30620| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLQGRWKPKMIGGIGGFIKVKQYDEIP
LEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006