<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1222 1222-30716 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184MV, L210LW, T215Y K219KR L100I, K103N   E44ED, V118I, K122E, V179I, T200A, E203D, Q207K, H208HY, R211K, L228R K223KPQT
>1222-30716| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRAKIDELRKYLWKWGFYTP
DRKHQTEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82VA, I84V, L90M   L10I, T12P, K20KR, E35D, M36IV, N37D, I62IV, L63P, A71T, I72V, V77I, I93L, C95CF  
>1222-30716| codons 4-99
TLWQRPIVPIKIGGQLREALLDTGADDTVLEDVDLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKTVGTVLIGPTPANVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006