<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1217 1217-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48GA, I54V, V82A, I84IV, L90M L23LI, K43T, F53FL, G73S L10I, T12S, L19IV, I62V, L63P, A71V  
>1217-30707| codons 4-99
TLWQRPIVSIKIGGQVKEAILDTGADDTVLEEMNLPGRWTPKLIAGIGGLVKVRQYDQVP
IEICGHKVISTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184MV, L210W, T215Y K219NS K103KN V108VI T39E, E44D, A98AS, K102Q, V118I, I178IL, Q207E, H208Y, R211K, D218E, L228LH, D237DE  
>1217-30707| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
SGLKQNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYVDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTP
ESKHQKEPPFHWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006