<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1540 1540-30708 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54M, V82A, I84V, L90M Q58QE L10I, I15V, G16GA, K55R, R57K, D60DE, L63P, A71L, I93L  
>1540-30708| codons 4-99
TLWQRPIVTIKVAGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFMRVKEYEQIP
IEICGHKLIGTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219D Y181C   E40F, K43Q, V60I, S68G, V118I, K122E, I142V, H208Y, R211K, L228H, V245T  
>1540-30708| codons 38-247
CTFLEQEGKISKIGPENPYNTPIFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DDKHQKEPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006