<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1536 1536-30611 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A L33F, K43KT L10I, I13V, R41K, K45KQ, I64V, T74S, V77I, I93L  
>1536-30611| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGKWTPQMIVGIGGFSKVRQYDQIL
VEICGHKAIGSVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210LW, T215Y K219KR     T39A, A98S, K122E, I135R, I195L, R211DEKN D186DY
>1536-30611| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDYLYVGSDLELGQHRTKIEELRQHLWNWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006