<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1214 1214-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, V82A   L10IV, I15IM, N37D, K55R, I62V, L63P, A71V, V77VI, I93L G17EV
>1214-30630| codons 4-99
TLWQRPVVTIKMGVQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFVRVRQYDQVP
IEICGHKVIGTVVIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, T215Y   K103N   E53Q, V60I, V118VI, K122E, D123N, I135V, I142V, T200I, E203D, Q207A, R211T, V241A D113N, K201N
>1214-30630| codons 38-247
CTELEKEGKISKIGPQNPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGNAYFSIPLDENFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRINIDELRAHLLTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTAQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006