<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1213 1213-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N, Y181C   K43KQ, V60VI, T69N, V90I, K122E, I135IT, G196E, T200A, E203D, R211RK, D218E, L228H, V245L  
>1213-30501| codons 38-247
CTEMEQEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRAKIDELRQHLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82A, L90M V11I, L33F, Q58E, G73GS L10I, I13V, E35D, M36I, I62V, L63P, C67L, A71V, I72L K20GMRV
>1213-30501| codons 4-99
TLWQRPIITVKIGGQLVEALLDTGADDTVFEDINLPGRWKPKMIGGIGGFLKVREYDQVP
IEILGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006