<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1205 1205-30421 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   I135V, S162C, G196E, T200I, Q207E, D237N  
>1205-30421| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLLVGSDLEIEQHRIKIEELREHLLRWGFFTP
DEKHQKEPPFLWMGYELHPNKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, G73S L10I, R57K, I62V, L63P, A71V, V77I, I93L  
>1205-30421| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVKQYDQVP
IEICGHKVISTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006