<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1960 1960-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E L10V, I13V, K14R, I15V, Q18E, K20V, I62V, L63P, A71V, V77I, Q92K  
>1960-30714| codons 4-99
TLWQRPVVTVRVGGELVEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYDQVP
IEICGHKVIGTVLIGPTPVNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, L210LW, T215TNSY V75VM, K219N K103N V108VI, F227FL T107S, L109LIM, D121H, K122E, I135T, S162C, Q174QR, D177DE, I178IL, G196GE, I202IV, H208HY, R211K L228LFHY
>1960-30714| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVSIMDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKRNPELVIYQYMDDLYVGSDLEIEQHRTKVEELRQYLWKWGFYTP
DNKHQKEPPLYWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006