<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1959 1959-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K101E, Y181C   T39A, K43Q, K64KR, V118I, K122E, I135T, S162SN, V179VI, D218E, V245E  
>1959-30701| codons 38-247
CAELEQEGKISKIGPENPYNTPVFAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M V11IL, L33F, F53L, G73S, L89V L10IV, I13V, I15V, Q18QH, K20M, M36ML, K55KR, I62IV, L63P, A71V  
>1959-30701| codons 4-99
TLWQRPVLTVKVGGHLMEALLDTGADDTIFEELNLPGRWKPKIVGGIGGLLRVRQYDQVP
IEICGHKVISTVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006