<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1958 1958-30606 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, V82F L23I, L33I, Q58E L10I, Q18E, K20KR, E34D, E35D, M36I, N37C, I62V, L63P, H69R, L89M  
>1958-30606| codons 4-99
TLWQRPIVTIKIGGELREAILDTGADDTVIDDICLPGRWKPKMIGGIGGFVKVREYDQVP
IEICGRKAIGTVVVGPTPFNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   K103N V108I K43E, T69TN, V118I, K122KE, Q174QK, G196E, T200TA, R211K, L228LI R206I
>1958-30606| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSNKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVIYQYVDDLYVGSDLEIEQHRAKIEELIQHLWKWGFYTP
DKKHQKEPPFIWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006