<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1957 1957-30605 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, L90M M46V, Q58E, G73GC L10I, L19I, K20R, E35D, M36I, L63P, A71V, V77I, V82I, I93L  
>1957-30605| codons 4-99
TLWQRPIVTIKIGGQIREALLDTGADDTILEDINLPGRWKPKVVGGIGGFMKVREYDQIP
IEICGHKVICTVLIGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y       V60I, A98S, K122E, A158S, E203K, K223T K220KR
>1957-30605| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELRQHLWRWGFYTP
DKRHQTEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006