<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1754 1754-30516 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y188L   K43E, E44D, V118I, S162C, T165TI, R172RK, L210S, R211K, D218E, L228H, V245I  
>1754-30516| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMIKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLSKWGFYTP
EKKHQKEPPFHWMGYELHPDKWTVQPIILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82A, L90M   L10I, L63P, A71I, I93IM  
>1754-30516| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFMKVRQYDQIP
IEICGHKIIGTVLVGPTPANIIGRNLMTQMGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006