<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1752 1752-30505 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   L100I, K103N   T39TA, E44D, K102R, V118I, K122E, D123E, I135T, S162H, Q174R, V179VI, Q197K, R211AT  
>1752-30505| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQHSMTKILEPFRKRNPDIIIYQYMDDLYVGSDLEIGKHRTKIEELRQHLWTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M V11I, F53L, L89V L10I, T12S, I13V, L19Q, K20I, M36I, R41K, I62V, L63P, A71I, T74S, Q92R  
>1752-30505| codons 4-99
TLWQRPIISVKIGGQQIEALLDTGADDTVLEEINLPGKWKPKLIGGIGGLVKVRQYDQVP
IEICGHKIIGSVLVGPTPANIIGRNVMTRIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006