<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1750 1750-30418 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, V82A L24I, Q58E, G73A, T74P, L89V L10IV, L33M, N37D, K55R, I62V, L63P  
>1750-30418| codons 4-99
TLWQRPVVTIKIGGQLKEALIDTGADDTVMEEMDLPGRWKPKLIVGIGGFIRVREYDQVP
IEICGHKAIAPVLVGPTPANIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y K219R   V108I, K238N K43Q, E44D, K64R, V118I, T200TA, H208HY, R211K, L228R, V245Q R206I
>1750-30418| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIRKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELIQYLWKWGFYTP
DRKHQKEPPFRWMGYELHPDNWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006