<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1885 1885-30611 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L10F, V11I, L33F, Q58E, L89V I13V, I15V, K20IV, E35DN, M36I, L63P, A71V  
>1885-30611| codons 4-99
TLWQRPFITVKVGGQLVEALLDTGADDTIFENINLPGRWKPKIVGGIGGFMKVREYDQIP
IEICGHKVIGTVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, Y115F, Q151M, M184MV V75I, F77L, F116Y, K219Q Y181C, G190A   K101Q, K122E, D123N, Q174R, E203Q, R206RK, Q207E, F214FL  
>1885-30611| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAFYSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKRNPDIVICQYVDDLYVASDLEIGQHRTKIQELKEHLLRWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006