<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1834 1834-30522 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47V, I54IL, L90M L10F, I84IM I13V, I15V, K20I, E35D, M36I, R41RK, L63P, T74S  
>1834-30522| codons 4-99
TLWQRPFVTVKVGGQLIEALLDTGADDTILEDINLPGKWKPKMVGGIGGFLKVRQYDQIP
IEICGHKAIGSVLVGPTPVNMIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y D67DH, K219N   K101H T39A, K43E, V60I, T69N, K122E, D123E, I135T, I142V, Q174K, I178IFL, G196GE, Q207S N57NH, S68DN, S162*CWY
>1834-30522| codons 38-247
CAELEEEGKISKIGPENPYHTPIFAIKKKHNNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKKNPDLVIYQYMDDLYVGSDLEIEQHRTKIEELRSHLLRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006