<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1834 1834-30522 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I47V, I54IL, L90M L10F, I84IM I13V, I15V, K20I, E35D, M36I, R41RK, L63P, T74S  
>1834-30522| codons 4-99
TLWQRPFVTVKVGGQLIEALLDTGADDTILEDINLPGKWKPKMVGGIGGFLKVRQYDQIP
IEICGHKAIGSVLVGPTPVNMIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006