<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1690 1690-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M L10F, L33F, G73A I13V, E34Q, L63P, I66F, H69Q, V77I  
>1690-30501| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTIFQEMNLPGRWKPKIVGGIGGFMKVRQYDQIP
IEFCGQKAIATVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, L210W A62V, T215H G190S K101H A98S, K122E, D123DN, I135T, I178IM, T200A, H208Y, R211K, L228R, V245E  
>1690-30501| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
SGLHKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVSSDLEIGQHRAKIEELRQYLWKWGFHTP
DKKHQKEPPFRWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006