<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1689 1689-30428 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54V, V82A, L90M L10F, V11VI, L33F, G73S, L89V T12TS, I13V, K14KR, I15V, L19V, K20R, M36I, I62V, L63P, H69Q, A71V, I93M  
>1689-30428| codons 4-99
TLWQRPFISVRVGGQVREALLDTGADDTIFEEINLPGRWKPKMVGGIGGFVKVRQYDQVP
IEICGQKVISTVLVGPTPANIIGRNVMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184MV   Y181C   K49R, K122E, I135T, A158S, T165TI, E169D, I178L, R211K, L228Q, D237E, V245M  
>1689-30428| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQSSMIKILDPFRKQNPDLVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFQWMGYELHPEKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006