<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1288 CA7501 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 3TC+AZT 26
3 3TC+AZT+IDV 43
4 AZT+DDI+IDV+NVP 17
5 3TC+D4T+RTV+SQV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VA L24LI L10LI, E34EQ, N37A, R41K, R57RK, I62IV, L63A, A71V, V77I, I93L  
>CA7501| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLQEMALPGKWKPKMIGGIGGFVKVKQYD
QVAIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103KN   K122E, D123N, I135IT, Q207E, R211K, F214L, V245T, K277R, V292I, I293V, E297A  
>CA7502| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEIVPLTAEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005