<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1159 CA7500 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 DDI 26
3 D4T 18
4 AZT+D4T+IDV 26
5 AZT+DDI+NVP+RTV+SQV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V L10FY I15V, D60E, L63P, K70T, L89M  
>CA7500| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QIPIEICGHTAIGTVLVGPTPANVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106A   V35L, V179I, G196E, T200A, E203K, Q207E, E248D, A272P, T286A, E297K C280CR
>CA7499| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRAKIKELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLRKLLRGAKALTEVIPLTKE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005