<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1633 1633-30313 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54S, V82C, L90M L33LF L10I, R41K, L63GS, A71V, V77I, I93L  
>1633-30313| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIVGIGGFSKVRQYDQIS
IEICGHKVIGTVLIGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, K70N, V75I, F116Y Y181C A98G S68G, V118I, K122DN, D123E, T139TA, R172K, V179I, G196E, F214L, L228R, V245E  
>1633-30313| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGTNWRKLIDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYYSIPLDNEFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFKKQNPDIIICQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGLTTP
DKKHQKEPPFRWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006