<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1638 1638-30311 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V, L210W   K103N P225H K102Q, K122E, S162C, G196E, T200A, Q207E, R211K  
>1638-30311| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIEELREHLWKWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47IV, I54IM, V82A L24LI, L33LF L10I, R41K, Q61QHKN, I62IV, L63AT, I64V, E65D, T74S, V77I, I85IV  
>1638-30311| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTIFEEMNLPGKWKPKIVGGIGGFMKVRQYDNVT
VDICGHKAIGSVLIGPTPANIVGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006