<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1190 1190-30310 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, I84V, L90M L10F, L33F I13V, L19IT, K20R, E34A, E35D, M36I, K43Q, I62IV, L63P, A71I, P79S, L89I  
>1190-30310| codons 4-99
TLWQRPFVTVKIGGQTREALLDTGADDTIFADINLPGRWQPKMVGGIGGFMKVRQYDQVP
IEICGHKIIGTVLVGSTPVNVIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, V75M, M184V, L210W, T215Y   L100I, K103N   T39A, K43E, T69N, K102R, V118I, K122E, D177G, G196E, T200TA, E203K, Q207E, K223T, L228R, I244IV  
>1190-30310| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKDSNKWRKVMDFRELNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYVDDLYVGSDLEIEQHRAKIKELREHLWRWGFYTP
DKKHQTEPPFRWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006