<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1637 1637-30506 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   Y181C   V60I, S68G, V90I, V118I, I135T, S162D, Q207E, R211K, F214L, P243H, V245E  
>1637-30506| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQHIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84IV L10F, L24I, L33F T12P, I13V, K14R, K20T, N37H, R41K, L63P, K70KE, A71V, V77VI, I93L  
>1637-30506| codons 4-99
TLWQRPFVPVRIGGQLTEALIDTGADDTVFEEMHLPGKWKPKIIGGIGGFVKVRQYDQIP
IEICGHEVIGTVLIGPTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006