<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1196 1196-30912 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, I84V, L90M V11I, G73T L10I, I13V, Q18H, K20I, L33V, M36I, F53W, K55KR, L63P, I64V, A71V, I72IT  
>1196-30912| codons 1-99
PQITLWQRPIITVKIGGHLIEALLDTGADDTVVEEINLPGRWKPKIIGGIGGWARVRQYD
QIPVEICGHKVTTTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, T69D, K70R, Q151M V75I, F116Y, K219Q G190A Y318F A33V, V60I, V118I, K122E, D123E, I142V, S162Y, Q174K, N175Y, I178M, I180V, G196E, F214L, L228H, V245E, I293V, E297K, K331KR, Q334L, F346Y, M357T, G359S, V365I, T386I, I393IM K102Y
>1196-30912| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLVEICTEMEKEGKISKIGPENPYNTPI
FAIKRKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKYKKSVTVLDVGDAYYSIPL
DEEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQYSMTKILEPFRKKYPDMVV
YQYMDDLYVASDLEIEQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVFYDPSKDLIAEIQRQGLGQWTYQIYQEPYKNLKTGKYARTRSA
HTNDIKQLTEAVQKIATESIVIWGKIPKFKLPMQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006