<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1196 1196-30306 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54MV, I84V, L90M L10F, V11I, G73T I13V, Q18H, K20I, M36I, F53W, L63P, I64V, A71V, I72T  
>1196-30306| codons 4-99
TLWQRPFITVKIGGHLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGWVKVRQYDQIP
VEICGHKVTTTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M V75I, F116Y, K219Q K103N   V60I, K102*, V118I, K122E, D123E, I135T, S162Y, Q174K, N175Y, D177E, I178IM, I180V, G196E, F214L, L228H, V245E  
>1196-30306| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLK*NKSVTVLDVGDAYYSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQYSMTKILEPFRKKYPEMVVYQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGLTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006