<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1193 1193-30305 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V T215I, K219Q K103S, G190A   T39A, S48E, V60I, V118I, I135T, K166R, V179VI, E194K, G196E, F214L, L228H  
>1193-30305| codons 38-247
CAEMEKEGKIEKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIIIYQYVDDLYVASDLKIEQHRTKIEELRQHLLRWGLITP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A L33F, I47IK, N83D L10I, I13V, K20R, M36L, R41N, K45I, D60E, I62V, L63P, I64V  
>1193-30305| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEELNLPGNWKPIMKGGIGGFAKVRQYEQVP
VEICGHKAIGTVLVGPTPADIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006