<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1631 1631-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A, L90M V11I, L33F L10I, T12P, I13V, K14R, E34Q, L63P, A71V, I72V, V77I, Q92K, I93L  
>1631-30304| codons 4-99
TLWQRPIIPVRIGGQLKEALLDTGADDTVFQEMNLPGRWKPKMIGGIGGFAKVRQYDQIP
IEICGHKVVGTVLIGPTPANIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E K101E, Y181C, G190A   T39A, V60I, S105T, K122E, S162A, Q174H, G196E, E203D, R211RQ, D218E, H221Y, L228R  
>1631-30304| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKTVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKHNPDIVICQYVDDLYVASDLEIEQHRTKIDELRQHLWQWGFYTP
EEKYQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006