<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1198 1198-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76LV, V82VA, L90LM L33F, Q58E, G73GAST L10I, I13V, L19LI, E34EQ, N37D, K55KR, I62IV, L63LP, A71T, I72IL, V77I  
>1198-30304| codons 4-99
TLWQRPIVTVKIGGQIKEALLDTGADDTVFQEMDLPGRWKPKIIGGIGGFLRVREYDQVP
IEICGHKTLTTVVIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V T215I, K219E L100I, K103N   K102R, V118I, K173S, D177DE, I178L, V179I, T200A, I202V, F214L, L228H, V245E  
>1198-30304| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRSQNPELIIYQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGLITP
DEKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006