<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1194 1194-30303 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, K43T L10V, T12TK, I15V, L19LP, K20M, E35ED, M36V, R41RK, K55KR, Q61QH, I62V, L63P, I64V, I72IV, T74S, I85V, T91S  
>1194-30303| codons 4-99
TLWQRPVVKIKVGGQPMEALIDTGADDTVLEDVNLPGKWTPKLIGGIGGFVRVRQYDHVP
VEICGHKAVGSVLVGPTPANIVGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K103N, Y188HL   S68G, K102Q, K122E, I135T, S162Y, D177E, T200A  
>1194-30303| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006