<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1189 1189-30228 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F77L, F116Y, T215C Y188L, G190A   K49Q, S68G, K70X, K101Q, S162C, S163SAGT, I167IV, T200A, D237E  
>1189-30228| codons 38-247
CTEMEKEGKISQIGPENPYNTPVFVIKKKDGTXWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAFYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQCTMTKVLEPFRKQNPDIVIYQYVDDLLVASDLEIGQHRAKIEELRQHLLRWGFCTP
DKKHQKEPPFLWMGYELHPEKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M V11I, K43T, G73S, L89V L10I, I15V, Q18H, L19T, K20I, E34D, M36I, L63P, H69K, A71V, I85V  
>1189-30228| codons 4-99
TLWQRPIITIKVGGHTIEALLDTGADDTILDEINLPGRWTPKIVGGIGGFMKVRQYDQIP
IEICGKKVISTVLVGPTPANIVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006