<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1177 1177-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M V11I, Q58E, G73S L10I, I13V, K20I, E35D, M36I, N37D, K55R, R57K, D60E, L63P, A71V, I72L  
>1177-30528| codons 4-99
TLWQRPIITVKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVRVKEYEQIP
IEICGHKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   Y188L   E44D, V118I, D123E, I135T, K166Q, E169D, I178L, V179I, E203K, Q207D, H208Y, R211K, K223E, L228H  
>1177-30528| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTQILDPFRKQNPDLIIYQYMDDLLVGSDLEIGQHRTKIKELRDYLWKWGFYTP
DKKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006