<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1175 1175-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y V75L K103N, V106A   K43E, A98AS, I135V, D177E, I178L, H208Y, R211K, V245K  
>1175-30519| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKVLDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSATVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, L90M V11I, F53L L10I, I15V, L63P, A71V  
>1175-30519| codons 4-99
TLWQRPIITIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGVGGLIKVRQYDQIP
IEICGHKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006