<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1159 CA7495 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 DDI 26
3 D4T 18
4 AZT+D4T+IDV 26
5 AZT+DDI+NVP+RTV+SQV 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106A   V35L, E79ED, V179I, G196E, T200A, E203EK, Q207E, E248D L168LI, Q258QH, V261VL, L264LF, N265NS
>CA7495| codons 1-270
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRDLNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKIIEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRAKIKELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIHKLLGKFSWASQI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V   D60E, L63P, K70T, L89M  
>CA7496| codons 18-99
QLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYEQIPIEICGHTAIGTVLV
GPTPANVIGRNMLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005