<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1169 1169-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V, I54V, V82A, L90M L33F, Q58E, G73GC, L89LV L10I, T12I, I13V, G16A, E35D, M36I, N37D, D60E, I62V, L63P, A71V  
>1169-30304| codons 4-99
TLWQRPIVIVKIAGQLKEALLDTGADDTVFEDIDLPGRWKPKMIGGVGGFVKVREYEQVP
IEICGHKVICTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       T39A, K43E, E44D, W88C, V118I, K122E, I135L, S162Y, D177E, G196E, T200TS, E203K, Q207E, R211K, V245Q  
>1169-30304| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRSKIKELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006