<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1907 1907-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82F, L90M L23LI, L33LF, F53FL, G73GC L10I, I13V, D60E, Q61G, I62IV, L63P, K70R, A71AV, V77I, I93L I85IL
>1907-30630| codons 4-99
TLWQRPIVTVKIGGQLKEAILDTGADDTVFEEMNLPGRWKPKIIGGIGGLVKVRQYEGVP
IEICGHRVICTVLIGPTPFNILGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184V, L210W, T215Y V75VL, F77FL K103KN   K43Q, V60VI, V106VI, V118VI, K122E, G196K, T200TAEK, R211T, V245M  
>1907-30630| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKNSTKWRKILDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIKQHRKKIEELRQHLWTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006