<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1168 1168-30505 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54L, V82A, L90M L10F, L33F N37D, L63P, H69Q, A71V, I72V  
>1168-30505| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTIFEEMDLPGRWKPKIIGGIGGFLKVRQYDQIP
IEICGQKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y   K103N A98G, Y188F K43E, E44A, V60I, R83K, V118I, K122E, I135V, E138A, S162C, G196E, R211K, V245M  
>1168-30505| codons 38-247
CTELEEAGKISKIGPENPYNTPIFAIKKKNSDKWRKLMDFRELNKKTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLFVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006