<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1164 1164-30311 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M, M184V F116Y, T215V, K219Q K101E, Y181C   K49E, V118I, K122E, I135T, F214L, L228H  
>1164-30311| codons 38-247
CTEMEKEGKISEIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLVTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GA, I54V, V82A L24I, L33F, K43T L10I, T12P, I15IV, L19T, K20T, M36L, L63P, A71V, Q92K T91TAGS
>1164-30311| codons 4-99
TLWQRPIVPIKVGGQTTEALIDTGADDTVFEELNLPGRWTPKMIAGIGGFVKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLSKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006