<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1162 1162-30605 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54V, V82A L33F, K43T, N83ND L10I, K20R, E35D, M36IL, R57K, I62V, L63P, I72V, L89LM  
>1162-30605| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFEDLNLPGRWTPKMIVGVGGFVKVKQYDQVP
IEICGHKAVGTVLVGPTPADIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     E138K S68G, V90I, A98S, K101Q, D123E, I142T, I195IL, G196E, I202V, L210LF, R211KQ  
>1162-30605| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHP
SGLQKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNKTPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLELEQHRTKVEELRQHLFQWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006