<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2061 2061-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215FL K219E Y181C   T69N, V90I, K122P, S162G, K173E, T200TA, I202IV, R211K  
>2061-30707| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQGSMTKILEPFREQNPDIVICQYMDDLYVGSDLEIGQHRAKVEELRQHLLKWGFLTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73GC L10LI, T12K, L19LI, N37D, I62V, L63P, H69HR, I72IM, V77I  
>2061-30707| codons 4-99
TLWQRPIVKIKIGGQIKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYDQVP
IEICGRKAMCTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006