<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2060 2060-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, D67T, V75I, F77L, F116Y, K219Q Y181I V108I S68G, T69X, K101Q, L109I, S162Y, Q174QR, V179I, V189VI, T200A, I202V, E203K, Q207E, L210F, R211K, D218E, K223Q, L228H, P243S, V245E  
>2060-30626| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKTGXKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTIIDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQYSMTKILEPFRKRNPDIIIIQYMDDLYIGSDLEIGQHRAKVKELREHLFKWGFTTP
EQKHQQEPPFHWMGYELHPDKWTVQSIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M K43T L10V, I13V, K14KR, Q18K, K20KM, E35ED, M36I, N37D, D60E, I62V, L63P, I64V, K70R, T91TS  
>2060-30626| codons 4-99
TLWQRPVVTVRIGGKLMEALLDTGADDTVLEDIDLPGRWTPKMIVGIGGFVKVRQYEQVP
VEICGHRAIGTVLVGPTPANIIGRNLMSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006